PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919875.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 317aa    MW: 35591.8 Da    PI: 5.8727
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919875.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM100.13.2e-3127257128
             NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ew+fF++rd+ky++g+r+nrat+sgyWkatg+d+++++ ++++ gl+ktLvfy+grap ge+tdWvmheyrl
  XP_010919875.1   2 EWFFFCPRDRKYPNGSRTNRATASGYWKATGRDRKIIC-ESSVHGLRKTLVFYRGRAPGGERTDWVMHEYRL 72 
                     8*************************************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.953195IPR003441NAC domain
SuperFamilySSF1019411.28E-34294IPR003441NAC domain
PfamPF023652.5E-15372IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEWFFFCPRD RKYPNGSRTN RATASGYWKA TGRDRKIICE SSVHGLRKTL VFYRGRAPGG  60
ERTDWVMHEY RLCEYRSDGS SNFVGAFSLC HIVKRHDHGQ KIGDLQGESR ARKGHSSAMT  120
DFSPKMCFSN VLSTSEENQS VVIDLNRSNG STRSNSLENL RGNELHQIMI DSDQTDLCRS  180
RVVSDASKVS SPKEGISESM ITNVFPSSIE ICTPCNPSPF SSCENFREEA YMIDELNGHG  240
CSSSCPSPVY CMDMFSSVED ITLQSLEWDT PKYMNASSSV AGIETWNPVF PPPICRQASV  300
GEEVNLWFQD DSMVIVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-32210175174NAC domain-containing protein 19
3swm_B6e-32210175174NAC domain-containing protein 19
3swm_C6e-32210175174NAC domain-containing protein 19
3swm_D6e-32210175174NAC domain-containing protein 19
3swp_A6e-32210175174NAC domain-containing protein 19
3swp_B6e-32210175174NAC domain-containing protein 19
3swp_C6e-32210175174NAC domain-containing protein 19
3swp_D6e-32210175174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919875.10.0PREDICTED: NAC transcription factor 25-like isoform X3
TrEMBLM0RT581e-102M0RT58_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17780_0011e-101(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-44NAC domain containing protein 71